PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C026196P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 181aa    MW: 20257.6 Da    PI: 9.3271
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C026196P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.1e-4291167278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     C v+gC +dls+ ++yhrrhkvCe hsk+p+v++ gl+qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  MELO3C026196P1  91 CLVDGCVSDLSNYRDYHRRHKVCELHSKTPQVTIGGLTQRFCQQCSRFHSLDEFDEGKRSCRKRLDGHNRRRRKPQS 167
                     **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3483152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.63388165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-3990170IPR004333Transcription factor, SBP-box
PfamPF031106.7E-3291164IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MDWNLKTPSW DFTQLEQDAL KNINTIGASS NFVEHITTSG DFTVDLKLGQ VSNLGTKYVV  60
NEPGVFKVTP SPSEPSKRAR GSGNGAQPSS CLVDGCVSDL SNYRDYHRRH KVCELHSKTP  120
QVTIGGLTQR FCQQCSRFHS LDEFDEGKRS CRKRLDGHNR RRRKPQSDSL SRSILSHYQG  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3181164184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147164KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818140.0LN681814.1 Cucumis melo genomic scaffold, anchoredscaffold00089.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464414.11e-131PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_008464415.11e-131PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_008464416.11e-131PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_008464417.11e-131PREDICTED: squamosa promoter-binding-like protein 13A
SwissprotB9DI203e-48SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI113e-48SP13B_ARATH; Squamosa promoter-binding-like protein 13B
SwissprotQ0J0K18e-48SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A0A0LNV81e-127A0A0A0LNV8_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s10260.11e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-49SBP family protein